Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LDHB monoclonal antibody (M01), clone 2H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about LDHB monoclonal antibody (M01), clone 2H6
| Brand: | Abnova |
| Reference: | H00003945-M01 |
| Product name: | LDHB monoclonal antibody (M01), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant LDHB. |
| Clone: | 2H6 |
| Isotype: | IgG1 kappa |
| Gene id: | 3945 |
| Gene name: | LDHB |
| Gene alias: | LDH-H|TRG-5 |
| Gene description: | lactate dehydrogenase B |
| Genbank accession: | BC002362 |
| Immunogen: | LDHB (AAH02362.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
| Protein accession: | AAH02362.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (62.48 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to LDHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Membrane Type 1-Matrix Metalloproteinase/Akt Signaling Axis Modulates TNF-α-Induced Procoagulant Activity and Apoptosis in Endothelial Cells.Ohkawara H, Ishibashi T, Sugimoto K, Ikeda K, Ogawa K, Takeishi Y PLoS One. 2014 Aug 27;9(8):e105697. doi: 10.1371/journal.pone.0105697. eCollection 2014. |