Cart 2 Product Products 461,67 € (empty)
No products
To be determined Shipping
461,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 461,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 461,67 €
Data sheet of LCK monoclonal antibody (M11), clone 3H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about LCK monoclonal antibody (M11), clone 3H5
| Brand: | Abnova |
| Reference: | H00003932-M11 |
| Product name: | LCK monoclonal antibody (M11), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LCK. |
| Clone: | 3H5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3932 |
| Gene name: | LCK |
| Gene alias: | YT16|p56lck|pp58lck |
| Gene description: | lymphocyte-specific protein tyrosine kinase |
| Genbank accession: | BC013200 |
| Immunogen: | LCK (AAH13200, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKA |
| Protein accession: | AAH13200 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LCK expression in transfected 293T cell line by LCK monoclonal antibody (M11), clone 3H5. Lane 1: LCK transfected lysate(58.001 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |