No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003914-M01 |
Product name: | LAMB3 monoclonal antibody (M01), clone 2G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LAMB3. |
Clone: | 2G10 |
Isotype: | IgG1 Kappa |
Gene id: | 3914 |
Gene name: | LAMB3 |
Gene alias: | BM600-125KDA|FLJ99565|LAM5|LAMNB1 |
Gene description: | laminin, beta 3 |
Genbank accession: | NM_000228 |
Immunogen: | LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC |
Protein accession: | NP_000219 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | LAMB3 monoclonal antibody (M01), clone 2G10 Western Blot analysis of LAMB3 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Clinical significance of LAMB3 and COL7A1 mRNA in esophageal squamous cell carcinoma.Kita Y, Mimori K, Tanaka F, Matsumoto T, Haraguchi N, Ishikawa K, Matsuzaki S, Fukuyoshi Y, Inoue H, Natsugoe S, Aikou T, Mori M. Eur J Surg Oncol. 2009 Jan;35(1):52-58. Epub 2008 Mar 10. |