Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LAMA5 monoclonal antibody (M01), clone 2F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about LAMA5 monoclonal antibody (M01), clone 2F7
| Brand: | Abnova |
| Reference: | H00003911-M01 |
| Product name: | LAMA5 monoclonal antibody (M01), clone 2F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LAMA5. |
| Clone: | 2F7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3911 |
| Gene name: | LAMA5 |
| Gene alias: | KIAA1907 |
| Gene description: | laminin, alpha 5 |
| Genbank accession: | BC003355 |
| Immunogen: | LAMA5 (AAH03355.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP |
| Protein accession: | AAH03355.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged LAMA5 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion.Little GH, Noushmehr H, Baniwal SK, Berman BP, Coetzee GA, Frenkel B. Nucleic Acids Res. 2011 Dec 19. |