LAMA4 purified MaxPab mouse polyclonal antibody (B02P) View larger

LAMA4 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAMA4 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LAMA4 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00003910-B02P
Product name: LAMA4 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human LAMA4 protein.
Gene id: 3910
Gene name: LAMA4
Gene alias: DKFZp686D23145|LAMA3|LAMA4*-1
Gene description: laminin, alpha 4
Genbank accession: BC004241.1
Immunogen: LAMA4 (AAH04241.1, 1 a.a. ~ 120 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL
Protein accession: AAH04241.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003910-B02P-13-15-1.jpg
Application image note: Western Blot analysis of LAMA4 expression in transfected 293T cell line (H00003910-T02) by LAMA4 MaxPab polyclonal antibody.

Lane 1: LAMA4 transfected lysate(13.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LAMA4 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart