| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00003910-B02P |
| Product name: | LAMA4 purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LAMA4 protein. |
| Gene id: | 3910 |
| Gene name: | LAMA4 |
| Gene alias: | DKFZp686D23145|LAMA3|LAMA4*-1 |
| Gene description: | laminin, alpha 4 |
| Genbank accession: | BC004241.1 |
| Immunogen: | LAMA4 (AAH04241.1, 1 a.a. ~ 120 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL |
| Protein accession: | AAH04241.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of LAMA4 expression in transfected 293T cell line (H00003910-T02) by LAMA4 MaxPab polyclonal antibody. Lane 1: LAMA4 transfected lysate(13.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |