| Brand: | Abnova |
| Reference: | H00003908-M01 |
| Product name: | LAMA2 monoclonal antibody (M01), clone 2D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LAMA2. |
| Clone: | 2D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3908 |
| Gene name: | LAMA2 |
| Gene alias: | LAMM |
| Gene description: | laminin, alpha 2 |
| Genbank accession: | NM_000426 |
| Immunogen: | LAMA2 (NP_000417, 3013 a.a. ~ 3122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTNDPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPAN |
| Protein accession: | NP_000417 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to LAMA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Advanced Intimal Hyperplasia Without Luminal Narrowing of Leptomeningeal Arteries in CADASIL.Dong H, Ding H, Young K, Blaivas M, Christensen PJ, Wang MM Stroke. 2013 Mar 12. |