Cart 19 Product Products 5 837,42 € (empty)
No products
To be determined Shipping
5 837,42 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 19 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 5 837,42 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 5 837,42 €
Data sheet of LAG3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about LAG3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00003902-D01P |
| Product name: | LAG3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human LAG3 protein. |
| Gene id: | 3902 |
| Gene name: | LAG3 |
| Gene alias: | CD223 |
| Gene description: | lymphocyte-activation gene 3 |
| Genbank accession: | BC052589 |
| Immunogen: | LAG3 (AAH52589.1, 1 a.a. ~ 360 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE |
| Protein accession: | AAH52589.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LAG3 expression in transfected 293T cell line (H00003902-T02) by LAG3 MaxPab polyclonal antibody. Lane 1: LAG3 transfected lysate(39.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | CRYAB modulates the activation of CD4+ T cells from relapsing-remitting multiple sclerosis patients.Quach QL, Metz LM, Thomas JC, Rothbard JB, Steinman L, Ousman SS Mult Scler. 2013 Jun 4. |