| Brand: | Abnova |
| Reference: | H00003897-M11 |
| Product name: | L1CAM monoclonal antibody (M11), clone 3B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant L1CAM. |
| Clone: | 3B10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3897 |
| Gene name: | L1CAM |
| Gene alias: | CAML1|CD171|HSAS|HSAS1|MASA|MIC5|N-CAML1|S10|SPG1 |
| Gene description: | L1 cell adhesion molecule |
| Genbank accession: | NM_000425 |
| Immunogen: | L1CAM (NP_000416, 23 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKLGTAMSHEIRLMA |
| Protein accession: | NP_000416 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged L1CAM is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |