No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00003845-M02A |
| Product name: | KRAS monoclonal antibody (M02A), clone 4F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KRAS. |
| Clone: | 4F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3845 |
| Gene name: | KRAS |
| Gene alias: | C-K-RAS|K-RAS2A|K-RAS2B|K-RAS4A|K-RAS4B|KI-RAS|KRAS1|KRAS2|NS3|RASK2 |
| Gene description: | v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog |
| Genbank accession: | NM_004985 |
| Immunogen: | KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV |
| Protein accession: | NP_004976 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | KRAS monoclonal antibody (M02A), clone 4F3 Western Blot analysis of KRAS expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |