| Brand: | Abnova |
| Reference: | H00003823-M01 |
| Product name: | KLRC3 monoclonal antibody (M01), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLRC3. |
| Clone: | 3D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3823 |
| Gene name: | KLRC3 |
| Gene alias: | NKG2-E|NKG2E |
| Gene description: | killer cell lectin-like receptor subfamily C, member 3 |
| Genbank accession: | NM_002261 |
| Immunogen: | KLRC3 (NP_002252, 132 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS |
| Protein accession: | NP_002252 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged KLRC3 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Human NKG2E Is Expressed and Forms an Intracytoplasmic Complex with CD94 and DAP12.Orbelyan GA, Tang F, Sally B, Solus J, Meresse B, Ciszewski C, Grenier JC, Barreiro LB, Lanier LL, Jabri B J Immunol. 2014 Jul 15;193(2):610-6. doi: 10.4049/jimmunol.1400556. Epub 2014 Jun 16. |