| Brand: | Abnova |
| Reference: | H00003821-M01 |
| Product name: | KLRC1 monoclonal antibody (M01), clone 2C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLRC1. |
| Clone: | 2C3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3821 |
| Gene name: | KLRC1 |
| Gene alias: | CD159A|MGC13374|MGC59791|NKG2|NKG2A |
| Gene description: | killer cell lectin-like receptor subfamily C, member 1 |
| Genbank accession: | NM_213658 |
| Immunogen: | KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK |
| Protein accession: | NP_998823 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |