No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003820-A01 |
Product name: | KLRB1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant KLRB1. |
Gene id: | 3820 |
Gene name: | KLRB1 |
Gene alias: | CD161|CLEC5B|MGC138614|NKR|NKR-P1|NKR-P1A|NKRP1A|hNKR-P1A |
Gene description: | killer cell lectin-like receptor subfamily B, member 1 |
Genbank accession: | NM_002258 |
Immunogen: | KLRB1 (NP_002249, 126 a.a. ~ 225 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ESSLLLIRDKDELIHTQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQKELTPVRNKVYPDS |
Protein accession: | NP_002249 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |