Cart 111 Product Products 36 143,75 € (empty)
No products
To be determined Shipping
36 143,75 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 111 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 36 143,75 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 36 143,75 €
Data sheet of KLK1 (Human) Recombinant Protein (P01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about KLK1 (Human) Recombinant Protein (P01)
| Brand: | Abnova |
| Reference: | H00003816-P01 |
| Product name: | KLK1 (Human) Recombinant Protein (P01) |
| Product description: | Human KLK1 full-length ORF ( NP_002248.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 3816 |
| Gene name: | KLK1 |
| Gene alias: | KLKR|Klk6|hK1 |
| Gene description: | kallikrein 1 |
| Genbank accession: | NM_002257.2 |
| Immunogen sequence/protein sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS |
| Protein accession: | NP_002248.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Neutrophil-Derived Proteinase 3 Induces Kallikrein-Independent Release of a Novel Vasoactive Kinin.Kahn R, Hellmark T, Leeb-Lundberg LM, Akbari N, Todiras M, Olofsson T, Wieslander J, Christensson A, Westman K, Bader M, Muller-Esterl W, Karpman D. J Immunol. 2009 Jun 15;182(12):7906-15. |