View larger

KCNK1 monoclonal antibody (M01), clone 4D7

Reference:

Condition: New product

Data sheet of KCNK1 monoclonal antibody (M01), clone 4D7

Brand:	Abnova
Reference:	H00003775-M01
Product name:	KCNK1 monoclonal antibody (M01), clone 4D7
Product description:	Mouse monoclonal antibody raised against a partial recombinant KCNK1.
Clone:	4D7
Isotype:	IgG1 Kappa
Gene id:	3775
Gene name:	KCNK1
Gene alias:	DPK\|HOHO\|K2p1.1\|KCNO1\|TWIK-1\|TWIK1
Gene description:	potassium channel, subfamily K, member 1
Genbank accession:	NM_002245
Immunogen:	KCNK1 (NP_002236.1, 265 a.a. ~ 336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
Protein accession:	NP_002236.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (33.66 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged KCNK1 is 0.1 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice