Cart 68 Product Products 25 313,01 € (empty)
No products
To be determined Shipping
25 313,01 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 68 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 25 313,01 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 25 313,01 €
Data sheet of KCNA4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about KCNA4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003739-A01 |
| Product name: | KCNA4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KCNA4. |
| Gene id: | 3739 |
| Gene name: | KCNA4 |
| Gene alias: | HBK4|HK1|HPCN2|HUKII|KCNA4L|KCNA8|KV1.4|PCN2 |
| Gene description: | potassium voltage-gated channel, shaker-related subfamily, member 4 |
| Genbank accession: | NM_002233 |
| Immunogen: | KCNA4 (NP_002224, 562 a.a. ~ 652 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETD |
| Protein accession: | NP_002224 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |