No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003738-M01 |
Product name: | KCNA3 monoclonal antibody (M01), clone 1D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KCNA3. |
Clone: | 1D8 |
Isotype: | IgG1 Kappa |
Gene id: | 3738 |
Gene name: | KCNA3 |
Gene alias: | HGK5|HLK3|HPCN3|HUKIII|KV1.3|MK3|PCN3 |
Gene description: | potassium voltage-gated channel, shaker-related subfamily, member 3 |
Genbank accession: | BC035059 |
Immunogen: | KCNA3 (AAH35059, 424 a.a. ~ 523 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV |
Protein accession: | AAH35059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | KCNA3 monoclonal antibody (M01), clone 1D8 Western Blot analysis of KCNA3 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |