Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KAL1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about KAL1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003730-A01 |
| Product name: | KAL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KAL1. |
| Gene id: | 3730 |
| Gene name: | KAL1 |
| Gene alias: | ADMLX|HHA|KAL|KALIG-1|KMS |
| Gene description: | Kallmann syndrome 1 sequence |
| Genbank accession: | NM_000216 |
| Immunogen: | KAL1 (NP_000207, 548 a.a. ~ 657 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPMTGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRTPELPP |
| Protein accession: | NP_000207 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | KAL1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of KAL1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Kallmann Syndrome 1 Gene Is Expressed in the Marsupial Gonad.Hu Y, Yu H, Shaw G, Pask AJ, Renfree MB. Biol Reprod. 2010 Dec 1. [Epub ahead of print] |