| Brand: | Abnova |
| Reference: | H00003708-A01 |
| Product name: | ITPR1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ITPR1. |
| Gene id: | 3708 |
| Gene name: | ITPR1 |
| Gene alias: | INSP3R1|IP3R|IP3R1|SCA15|SCA16 |
| Gene description: | inositol 1,4,5-triphosphate receptor, type 1 |
| Genbank accession: | NM_002222 |
| Immunogen: | ITPR1 (NP_002213, 2470 a.a. ~ 2577 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI |
| Protein accession: | NP_002213 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |