ITK polyclonal antibody (A01) View larger

ITK polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ITK polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA

More info about ITK polyclonal antibody (A01)

Brand: Abnova
Reference: H00003702-A01
Product name: ITK polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ITK.
Gene id: 3702
Gene name: ITK
Gene alias: EMT|LYK|MGC126257|MGC126258|PSCTK2
Gene description: IL2-inducible T-cell kinase
Genbank accession: NM_005546
Immunogen: ITK (NP_005537, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETR
Protein accession: NP_005537
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003702-A01-1-35-1.jpg
Application image note: ITK polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ITK expression in Y-79 ( Cat # L042V1 ).
Applications: WB-Ce,ELISA
Shipping condition: Dry Ice

Reviews

Buy ITK polyclonal antibody (A01) now

Add to cart