| Brand: | Abnova |
| Reference: | H00003702-A01 |
| Product name: | ITK polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ITK. |
| Gene id: | 3702 |
| Gene name: | ITK |
| Gene alias: | EMT|LYK|MGC126257|MGC126258|PSCTK2 |
| Gene description: | IL2-inducible T-cell kinase |
| Genbank accession: | NM_005546 |
| Immunogen: | ITK (NP_005537, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETR |
| Protein accession: | NP_005537 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ITK polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ITK expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |