Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITGB8 monoclonal antibody (M01), clone 2B4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about ITGB8 monoclonal antibody (M01), clone 2B4
| Brand: | Abnova |
| Reference: | H00003696-M01 |
| Product name: | ITGB8 monoclonal antibody (M01), clone 2B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITGB8. |
| Clone: | 2B4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3696 |
| Gene name: | ITGB8 |
| Gene alias: | - |
| Gene description: | integrin, beta 8 |
| Genbank accession: | NM_002214 |
| Immunogen: | ITGB8 (NP_002205, 392 a.a. ~ 503 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE |
| Protein accession: | NP_002205 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.06 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of ITGB8 transfected lysate using anti-ITGB8 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ITGB8 MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | beta5 integrin is the major contributor to the αVintegrin-mediated blockade of HIV-1 replication.Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Este JA. J Immunol. 2011 Jan 1;186(1):464-70. Epub 2010 Nov 22. |