| Brand: | Abnova |
| Reference: | H00003693-M01 |
| Product name: | ITGB5 monoclonal antibody (M01), clone 2C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITGB5. |
| Clone: | 2C4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3693 |
| Gene name: | ITGB5 |
| Gene alias: | FLJ26658 |
| Gene description: | integrin, beta 5 |
| Genbank accession: | NM_002213 |
| Immunogen: | ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA |
| Protein accession: | NP_002204 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ITGB5 monoclonal antibody (M01), clone 2C4 Western Blot analysis of ITGB5 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | beta5 integrin is the major contributor to the αVintegrin-mediated blockade of HIV-1 replication.Ballana E, Pauls E, Clotet B, Perron-Sierra F, Tucker GC, Este JA. J Immunol. 2011 Jan 1;186(1):464-70. Epub 2010 Nov 22. |