Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITGA2 monoclonal antibody (M01), clone 2B6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about ITGA2 monoclonal antibody (M01), clone 2B6
| Brand: | Abnova |
| Reference: | H00003673-M01 |
| Product name: | ITGA2 monoclonal antibody (M01), clone 2B6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITGA2. |
| Clone: | 2B6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3673 |
| Gene name: | ITGA2 |
| Gene alias: | BR|CD49B|GPIa|VLA-2|VLAA2 |
| Gene description: | integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) |
| Genbank accession: | NM_002203 |
| Immunogen: | ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL |
| Protein accession: | NP_002194.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ITGA2 monoclonal antibody (M01), clone 2B6 Western Blot analysis of ITGA2 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification and Characterization of the Integrin {alpha}2{beta}1 Binding Motif in Chondroadherin Mediating Cell Attachment.Haglund L, Tillgren V, Addis L, Wenglen C, Recklies A, Heinegard D. J Biol Chem. 2011 Feb 4;286(5):3925-34. Epub 2010 Dec 2. |