Brand: | Abnova |
Reference: | H00003663-M05A |
Product name: | IRF5 monoclonal antibody (M05A), clone 2D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IRF5. |
Clone: | 2D4 |
Isotype: | IgG1 Kappa |
Gene id: | 3663 |
Gene name: | IRF5 |
Gene alias: | SLEB10 |
Gene description: | interferon regulatory factor 5 |
Genbank accession: | NM_002200 |
Immunogen: | IRF5 (NP_002191, 395 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ |
Protein accession: | NP_002191 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IRF5 monoclonal antibody (M05A), clone 2D4 Western Blot analysis of IRF5 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |