| Brand: | Abnova |
| Reference: | H00003659-M01 |
| Product name: | IRF1 monoclonal antibody (M01), clone 2E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IRF1. |
| Clone: | 2E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3659 |
| Gene name: | IRF1 |
| Gene alias: | IRF-1|MAR |
| Gene description: | interferon regulatory factor 1 |
| Genbank accession: | NM_002198 |
| Immunogen: | IRF1 (NP_002189, 216 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP |
| Protein accession: | NP_002189 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IRF1 monoclonal antibody (M01), clone 2E4 Western Blot analysis of IRF1 expression in COLO 320 HSR ( Cat # L020V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Defining critical roles for NF-κB p65 and type I interferon in innate immunity to rhinovirus.Bartlett NW, Slater L, Glanville N, Haas JJ, Caramori G, Casolari P, Clarke DL, Message SD, Aniscenko J, Kebadze T, Zhu J, Mallia P, Mizgerd JP, Belvisi M, Papi A, Kotenko SV, Johnston SL, Edwards MR. EMBO Mol Med. 2012 Dec;4(12):1244-60. doi: 10.1002/emmm.201201650. Epub 2012 Nov 14. |