| Brand: | Abnova |
| Reference: | H00003656-M01A |
| Product name: | IRAK2 monoclonal antibody (M01A), clone 6C7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IRAK2. |
| Clone: | 6C7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3656 |
| Gene name: | IRAK2 |
| Gene alias: | IRAK-2|MGC150550 |
| Gene description: | interleukin-1 receptor-associated kinase 2 |
| Genbank accession: | NM_001570 |
| Immunogen: | IRAK2 (NP_001561, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF |
| Protein accession: | NP_001561 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IRAK2 monoclonal antibody (M01A), clone 6C7 Western Blot analysis of IRAK2 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |