Brand: | Abnova |
Reference: | H00003651-D01P |
Product name: | PDX1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human PDX1 protein. |
Gene id: | 3651 |
Gene name: | PDX1 |
Gene alias: | GSF|IDX-1|IPF1|IUF1|MODY4|PDX-1|STF-1 |
Gene description: | pancreatic and duodenal homeobox 1 |
Genbank accession: | BC111592 |
Immunogen: | PDX1 (AAI11593.1, 1 a.a. ~ 283 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR |
Protein accession: | AAI11593.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | PDX1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PDX1 expression in mouse liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |