Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of EIF3S6 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about EIF3S6 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003646-A01 |
| Product name: | EIF3S6 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EIF3S6. |
| Gene id: | 3646 |
| Gene name: | EIF3E |
| Gene alias: | EIF3-P48|EIF3S6|INT6|eIF3-p46 |
| Gene description: | eukaryotic translation initiation factor 3, subunit E |
| Genbank accession: | NM_001568 |
| Immunogen: | EIF3S6 (NP_001559, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
| Protein accession: | NP_001559 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | EIF3S6 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of EIF3S6 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |