EIF3S6 polyclonal antibody (A01) View larger

EIF3S6 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF3S6 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about EIF3S6 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003646-A01
Product name: EIF3S6 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant EIF3S6.
Gene id: 3646
Gene name: EIF3E
Gene alias: EIF3-P48|EIF3S6|INT6|eIF3-p46
Gene description: eukaryotic translation initiation factor 3, subunit E
Genbank accession: NM_001568
Immunogen: EIF3S6 (NP_001559, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Protein accession: NP_001559
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003646-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003646-A01-1-35-1.jpg
Application image note: EIF3S6 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of EIF3S6 expression in Y-79 ( Cat # L042V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy EIF3S6 polyclonal antibody (A01) now

Add to cart