| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00003628-M11A |
| Product name: | INPP1 monoclonal antibody (M11A), clone 4F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant INPP1. |
| Clone: | 4F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3628 |
| Gene name: | INPP1 |
| Gene alias: | MGC110984 |
| Gene description: | inositol polyphosphate-1-phosphatase |
| Genbank accession: | NM_002194 |
| Immunogen: | INPP1 (NP_002185, 300 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT |
| Protein accession: | NP_002185 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of INPP1 expression in transfected 293T cell line by INPP1 monoclonal antibody (M11A), clone 4F9. Lane 1: INPP1 transfected lysate(44 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |