Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 286,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 286,00 €
Data sheet of INHA polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about INHA polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003623-A01 |
| Product name: | INHA polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant INHA. |
| Gene id: | 3623 |
| Gene name: | INHA |
| Gene alias: | - |
| Gene description: | inhibin, alpha |
| Genbank accession: | BC006391 |
| Immunogen: | INHA (AAH06391, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | TPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPG |
| Protein accession: | AAH06391 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Autoantibody response against NALP5/MATER in primary ovarian insufficiency and in autoimmune Addisons disease.Brozzetti A, Alimohammadi M, Morelli S, Minarelli V, Hallgren A, Giordano R, De Bellis A, Perniola R, Kampe O, Falorni A; Italian Addison Network. J Clin Endocrinol Metab. 2015 May;100(5):1941-8. doi: 10.1210/jc.2014-3571. Epub 2015 Mar 3. |