| Brand: | Abnova |
| Reference: | H00003621-M02A |
| Product name: | ING1 monoclonal antibody (M02A), clone 2E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ING1. |
| Clone: | 2E5 |
| Isotype: | IgM kappa |
| Gene id: | 3621 |
| Gene name: | ING1 |
| Gene alias: | p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a |
| Gene description: | inhibitor of growth family, member 1 |
| Genbank accession: | NM_198219.1 |
| Immunogen: | ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA |
| Protein accession: | NP_937862.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ING1 monoclonal antibody (M02A), clone 2E5 Western Blot analysis of ING1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |