Brand: | Abnova |
Reference: | H00003621-M01 |
Product name: | ING1 monoclonal antibody (M01), clone 1C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ING1. |
Clone: | 1C9 |
Isotype: | IgG1 kappa |
Gene id: | 3621 |
Gene name: | ING1 |
Gene alias: | p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a |
Gene description: | inhibitor of growth family, member 1 |
Genbank accession: | NM_198219.1 |
Immunogen: | ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA |
Protein accession: | NP_937862.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ING1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |