Cart 99 Product Products 31 883,18 € (empty)
No products
To be determined Shipping
31 883,18 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 99 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 31 883,18 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 31 883,18 €
Data sheet of IMPDH1 monoclonal antibody (M01), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about IMPDH1 monoclonal antibody (M01), clone 3G6
| Brand: | Abnova |
| Reference: | H00003614-M01 |
| Product name: | IMPDH1 monoclonal antibody (M01), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IMPDH1. |
| Clone: | 3G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3614 |
| Gene name: | IMPDH1 |
| Gene alias: | DKFZp781N0678|IMPD|IMPD1|LCA11|RP10|sWSS2608 |
| Gene description: | IMP (inosine monophosphate) dehydrogenase 1 |
| Genbank accession: | NM_000883 |
| Immunogen: | IMPDH1 (NP_000874, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDC |
| Protein accession: | NP_000874 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IMPDH1 monoclonal antibody (M01), clone 3G6 Western Blot analysis of IMPDH1 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Novel Direct Targets of miR-19a Identified in Breast Cancer Cells by a Quantitative Proteomic Approach.Ouchida M, Kanzaki H, Ito S, Hanafusa H, Jitsumori Y, Tamaru S, Shimizu K. PLoS One. 2012;7(8):e44095. Epub 2012 Aug 30. |