| Brand: | Abnova |
| Reference: | H00003611-M01 |
| Product name: | ILK monoclonal antibody (M01), clone 4F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ILK. |
| Clone: | 4F10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3611 |
| Gene name: | ILK |
| Gene alias: | DKFZp686F1765|P59 |
| Gene description: | integrin-linked kinase |
| Genbank accession: | BC001554 |
| Immunogen: | ILK (AAH01554, 341 a.a. ~ 452 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK |
| Protein accession: | AAH01554 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.06 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | ILK monoclonal antibody (M01), clone 4F10 Western Blot analysis of ILK expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |