Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 571,14 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 571,14 €
Data sheet of TNFRSF9 monoclonal antibody (M04), clone 4H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TNFRSF9 monoclonal antibody (M04), clone 4H4
| Brand: | Abnova |
| Reference: | H00003604-M04 |
| Product name: | TNFRSF9 monoclonal antibody (M04), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF9. |
| Clone: | 4H4 |
| Isotype: | IgM Kappa |
| Gene id: | 3604 |
| Gene name: | TNFRSF9 |
| Gene alias: | 4-1BB|CD137|CDw137|ILA|MGC2172 |
| Gene description: | tumor necrosis factor receptor superfamily, member 9 |
| Genbank accession: | BC006196.1 |
| Immunogen: | TNFRSF9 (AAH06196.1, 24 a.a. ~ 186 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Protein accession: | AAH06196.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |