Cart 53 Product Products 16 973,39 € (empty)
No products
To be determined Shipping
16 973,39 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 53 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 973,39 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 973,39 €
Data sheet of TNFRSF9 monoclonal antibody (M03), clone 3H5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA |
More info about TNFRSF9 monoclonal antibody (M03), clone 3H5
| Reference: | H00003604-M03 |
| Product name: | TNFRSF9 monoclonal antibody (M03), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF9. |
| Clone: | 3H5 |
| Isotype: | IgM Kappa |
| Gene id: | 3604 |
| Gene name: | TNFRSF9 |
| Gene alias: | 4-1BB|CD137|CDw137|ILA|MGC2172 |
| Gene description: | tumor necrosis factor receptor superfamily, member 9 |
| Genbank accession: | BC006196.1 |
| Immunogen: | TNFRSF9 (AAH06196.1, 24 a.a. ~ 186 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Protein accession: | AAH06196.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |