TNFRSF9 monoclonal antibody (M01), clone 5F8 View larger

TNFRSF9 monoclonal antibody (M01), clone 5F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF9 monoclonal antibody (M01), clone 5F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about TNFRSF9 monoclonal antibody (M01), clone 5F8

Brand: Abnova
Reference: H00003604-M01
Product name: TNFRSF9 monoclonal antibody (M01), clone 5F8
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF9.
Clone: 5F8
Isotype: IgG1 Kappa
Gene id: 3604
Gene name: TNFRSF9
Gene alias: 4-1BB|CD137|CDw137|ILA|MGC2172
Gene description: tumor necrosis factor receptor superfamily, member 9
Genbank accession: BC006196.1
Immunogen: TNFRSF9 (AAH06196.1, 46 a.a. ~ 128 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: SPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDAAFGTFNDQ
Protein accession: AAH06196.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003604-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (11.33 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFRSF9 monoclonal antibody (M01), clone 5F8 now

Add to cart