View larger

TNFRSF9 (Human) Recombinant Protein

Reference:

Condition: New product

Data sheet of TNFRSF9 (Human) Recombinant Protein

Brand:	Abnova
Reference:	H00003604-H01
Product name:	TNFRSF9 (Human) Recombinant Protein
Product description:	Purified TNFRSF9 (AAH06196.1 24 a.a. - 186 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Gene id:	3604
Gene name:	TNFRSF9
Gene alias:	4-1BB\|CD137\|CDw137\|ILA\|MGC2172
Gene description:	tumor necrosis factor receptor superfamily, member 9
Genbank accession:	BC006196.1
Immunogen sequence/protein sequence:	LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Protein accession:	AAH06196.1
Form:	Liquid
Concentration:	â‰¥ 10 ug/ml
Host cell:	Human HEK293T cells
Preparation method:	Transfection of pSuper-TNFRSF9 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
Storage buffer:	100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	SDS-PAGE and Western Blot
Quality control testing picture:
Tag:	His-Flag-StrepII
Product type:	Proteins
Host species:	Human
Antigen species / target species:	Human
Applications:	WB,ELISA,SDS-PAGE,PI
Shipping condition:	Dry Ice