No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA |
Brand: | Abnova |
Reference: | H00003600-M12 |
Product name: | IL15 monoclonal antibody (M12), clone 3B9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant IL15. |
Clone: | 3B9 |
Isotype: | IgG1 Kappa |
Gene id: | 3600 |
Gene name: | IL15 |
Gene alias: | IL-15|MGC9721 |
Gene description: | interleukin 15 |
Genbank accession: | NM_000585 |
Immunogen: | IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein. |
Immunogen sequence/protein sequence: | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Protein accession: | NP_000576 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to IL15 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA |
Shipping condition: | Dry Ice |