| Brand: | Abnova |
| Reference: | H00003600-M06 |
| Product name: | IL15 monoclonal antibody (M06), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant IL15. |
| Clone: | 3A3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3600 |
| Gene name: | IL15 |
| Gene alias: | IL-15|MGC9721 |
| Gene description: | interleukin 15 |
| Genbank accession: | NM_000585 |
| Immunogen: | IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein. |
| Immunogen sequence/protein sequence: | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Protein accession: | NP_000576 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |