IL15 purified MaxPab rabbit polyclonal antibody (D01P) View larger

IL15 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL15 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about IL15 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003600-D01P
Product name: IL15 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IL15 protein.
Gene id: 3600
Gene name: IL15
Gene alias: IL-15|MGC9721
Gene description: interleukin 15
Genbank accession: NM_000585
Immunogen: IL15 (NP_000576.1, 1 a.a. ~ 162 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Protein accession: NP_000576.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003600-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IL15 expression in transfected 293T cell line (H00003600-T01) by IL15 MaxPab polyclonal antibody.

Lane 1: IL15 transfected lysate(18.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL15 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart