Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL13RA2 monoclonal antibody (M01), clone 2E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about IL13RA2 monoclonal antibody (M01), clone 2E10
| Brand: | Abnova |
| Reference: | H00003598-M01 |
| Product name: | IL13RA2 monoclonal antibody (M01), clone 2E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL13RA2. |
| Clone: | 2E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3598 |
| Gene name: | IL13RA2 |
| Gene alias: | CD213A2|IL-13R|IL13BP |
| Gene description: | interleukin 13 receptor, alpha 2 |
| Genbank accession: | NM_000640 |
| Immunogen: | IL13RA2 (NP_000631, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET |
| Protein accession: | NP_000631 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL13RA2 monoclonal antibody (M01), clone 2E10. Western Blot analysis of IL13RA2 expression in HeLa. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Normal-appearing white matter in multiple sclerosis is in a subtle balance between inflammation and neuroprotection.Zeis T, Graumann U, Reynolds R, Schaeren-Wiemers N. Brain. 2008 Jan;131(Pt 1):288-303. Epub 2007 Dec 4. |