Brand: | Abnova |
Reference: | H00003596-M28 |
Product name: | IL13 monoclonal antibody (M28), clone 2D1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL13. |
Clone: | 2D1 |
Isotype: | IgG2a Kappa |
Gene id: | 3596 |
Gene name: | IL13 |
Gene alias: | ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600 |
Gene description: | interleukin 13 |
Genbank accession: | N/A |
Immunogen: | IL13 (P35225, 33 a.a. ~ 146 a.a) full-length recombinant protein. |
Immunogen sequence/protein sequence: | SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
Protein accession: | P35225 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (12.5 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |