IL13 monoclonal antibody (M28), clone 2D1 View larger

IL13 monoclonal antibody (M28), clone 2D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL13 monoclonal antibody (M28), clone 2D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IL13 monoclonal antibody (M28), clone 2D1

Brand: Abnova
Reference: H00003596-M28
Product name: IL13 monoclonal antibody (M28), clone 2D1
Product description: Mouse monoclonal antibody raised against a full-length recombinant IL13.
Clone: 2D1
Isotype: IgG2a Kappa
Gene id: 3596
Gene name: IL13
Gene alias: ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600
Gene description: interleukin 13
Genbank accession: N/A
Immunogen: IL13 (P35225, 33 a.a. ~ 146 a.a) full-length recombinant protein.
Immunogen sequence/protein sequence: SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
Protein accession: P35225
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003596-M28-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (12.5 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL13 monoclonal antibody (M28), clone 2D1 now

Add to cart