Cart 31 Product Products 9 643,20 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x STAT3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
9 643,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 31 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 9 643,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 9 643,20 €
Data sheet of IL13 monoclonal antibody (M28), clone 2D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about IL13 monoclonal antibody (M28), clone 2D1
| Brand: | Abnova |
| Reference: | H00003596-M28 |
| Product name: | IL13 monoclonal antibody (M28), clone 2D1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL13. |
| Clone: | 2D1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3596 |
| Gene name: | IL13 |
| Gene alias: | ALRH|BHR1|IL-13|MGC116786|MGC116788|MGC116789|P600 |
| Gene description: | interleukin 13 |
| Genbank accession: | N/A |
| Immunogen: | IL13 (P35225, 33 a.a. ~ 146 a.a) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | SPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN |
| Protein accession: | P35225 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (12.5 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |