| Brand: | Abnova |
| Reference: | H00003593-M01 |
| Product name: | IL12B monoclonal antibody (M01), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL12B. |
| Clone: | 2H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3593 |
| Gene name: | IL12B |
| Gene alias: | CLMF|CLMF2|IL-12B|NKSF|NKSF2 |
| Gene description: | interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) |
| Genbank accession: | NM_002187 |
| Immunogen: | IL12B (NP_002178, 229 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
| Protein accession: | NP_002178 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL12B monoclonal antibody (M01), clone 2H6. Western Blot analysis of IL12B expression in HepG2. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |