Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL12A monoclonal antibody (M02), clone 1A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about IL12A monoclonal antibody (M02), clone 1A6
| Brand: | Abnova |
| Reference: | H00003592-M02 |
| Product name: | IL12A monoclonal antibody (M02), clone 1A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL12A. |
| Clone: | 1A6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3592 |
| Gene name: | IL12A |
| Gene alias: | CLMF|IL-12A|NFSK|NKSF1|P35 |
| Gene description: | interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) |
| Genbank accession: | NM_000882 |
| Immunogen: | IL12A (NP_000873.2, 144 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Protein accession: | NP_000873.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of IL12A expression in transfected 293T cell line by IL12A monoclonal antibody (M02), clone 1A6. Lane 1: IL12A transfected lysate (Predicted MW: 28.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |