Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL11 monoclonal antibody (M04), clone 3C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about IL11 monoclonal antibody (M04), clone 3C6
| Brand: | Abnova |
| Reference: | H00003589-M04 |
| Product name: | IL11 monoclonal antibody (M04), clone 3C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL11. |
| Clone: | 3C6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3589 |
| Gene name: | IL11 |
| Gene alias: | AGIF|IL-11 |
| Gene description: | interleukin 11 |
| Genbank accession: | N/A |
| Immunogen: | IL11 (NP_000632, 23 a.a.-199 a.a.) partial recombinant protein. |
| Immunogen sequence/protein sequence: | GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Protein accession: | - |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |