No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00003588-Q01 |
Product name: | IL10RB (Human) Recombinant Protein (Q01) |
Product description: | Human IL10RB partial ORF ( NP_000619, 20 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 3588 |
Gene name: | IL10RB |
Gene alias: | CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2 |
Gene description: | interleukin 10 receptor, beta |
Genbank accession: | NM_000628 |
Immunogen sequence/protein sequence: | MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ |
Protein accession: | NP_000619 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Evidence for non-neutralizing autoantibodies against IL-10 signalling components in patients with inflammatory bowel disease.Frede N, Glocker EO, Wanders J, Engelhardt KR, Kreisel W, Ruemmele FM, Grimbacher B BMC Immunol. 2014 Feb 28;15(1):10. doi: 10.1186/1471-2172-15-10. |