No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP |
Brand: | Abnova |
Reference: | H00003588-G01 |
Product name: | IL10RB (Human) Recombinant Protein |
Product description: | Human IL10RB full-length ORF (NP_000619.3) recombinant protein without tag. |
Gene id: | 3588 |
Gene name: | IL10RB |
Gene alias: | CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2 |
Gene description: | interleukin 10 receptor, beta |
Genbank accession: | NM_000628.3 |
Immunogen sequence/protein sequence: | MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS |
Protein accession: | NP_000619.3 |
Form: | Liquid |
Preparation method: | in vitro wheat germ expression system with proprietary liposome technology |
Recommend dilutions: | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage buffer: | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | None |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP |
Shipping condition: | Dry Ice |