IL10RB purified MaxPab rabbit polyclonal antibody (D01P) View larger

IL10RB purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL10RB purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about IL10RB purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003588-D01P
Product name: IL10RB purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IL10RB protein.
Gene id: 3588
Gene name: IL10RB
Gene alias: CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2
Gene description: interleukin 10 receptor, beta
Genbank accession: BC001903.1
Immunogen: IL10RB (AAH01903.1, 1 a.a. ~ 325 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
Protein accession: AAH01903.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003588-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IL10RB expression in transfected 293T cell line (H00003588-T03) by IL10RB MaxPab polyclonal antibody.

Lane 1: IL10RB transfected lysate(35.75 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL10RB purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart