Cart 127 Product Products 51 354,47 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Btk...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Stat4...259,07 € -
-
-
-
-
1 x Nek4...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Tubulin α...259,07 € -
-
-
-
No products
To be determined Shipping
51 354,47 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 127 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 51 354,47 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 51 354,47 €
Data sheet of IL10RB purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about IL10RB purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00003588-B02P |
| Product name: | IL10RB purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human IL10RB protein. |
| Gene id: | 3588 |
| Gene name: | IL10RB |
| Gene alias: | CDW210B|CRF2-4|CRFB4|D21S58|D21S66|IL-10R2 |
| Gene description: | interleukin 10 receptor, beta |
| Genbank accession: | NM_000628.3 |
| Immunogen: | IL10RB (NP_000619.3, 1 a.a. ~ 325 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS |
| Protein accession: | NP_000619.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of IL10RB expression in transfected 293T cell line (H00003588-T02) by IL10RB MaxPab polyclonal antibody. Lane 1: IL10RB transfected lysate(37.00 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |