IL10 monoclonal antibody (M03A), clone 1C10 View larger

IL10 monoclonal antibody (M03A), clone 1C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL10 monoclonal antibody (M03A), clone 1C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about IL10 monoclonal antibody (M03A), clone 1C10

Brand: Abnova
Reference: H00003586-M03A
Product name: IL10 monoclonal antibody (M03A), clone 1C10
Product description: Mouse monoclonal antibody raised against a partial recombinant IL10.
Clone: 1C10
Isotype: IgG3 Kappa
Gene id: 3586
Gene name: IL10
Gene alias: CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF
Gene description: interleukin 10
Genbank accession: NM_000572
Immunogen: IL10 (AAI04253.1, 74 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Protein accession: AAI04253.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003586-M03A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003586-M03A-13-15-1.jpg
Application image note: Western Blot analysis of IL10 expression in transfected 293T cell line by IL10 monoclonal antibody (M03A), clone 1C10.

Lane 1: IL10 transfected lysate(20.5 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL10 monoclonal antibody (M03A), clone 1C10 now

Add to cart