Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003586-M03A |
Product name: | IL10 monoclonal antibody (M03A), clone 1C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL10. |
Clone: | 1C10 |
Isotype: | IgG3 Kappa |
Gene id: | 3586 |
Gene name: | IL10 |
Gene alias: | CSIF|IL-10|IL10A|MGC126450|MGC126451|TGIF |
Gene description: | interleukin 10 |
Genbank accession: | NM_000572 |
Immunogen: | IL10 (AAI04253.1, 74 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Protein accession: | AAI04253.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IL10 expression in transfected 293T cell line by IL10 monoclonal antibody (M03A), clone 1C10. Lane 1: IL10 transfected lysate(20.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |